Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.105 1.6

Expression

AA Sequence

MRPLPSGRRKTRGISLGLFALCLAAARCLQSQGVSLYIPQATINATVKEDILLSVEYSCHGVPTIEWTYS      1 - 70
SNWGTQKIVEWKPGTQANISQSHKDRVCTFDNGSIQLFSVGVRDSGYYVITVTERLGSSQFGTIVLHVSE     71 - 140
ILYEDLHFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELEDVEC              141 - 200
//

Text Mined References (1)

PMID Year Title