Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.56
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Eosinophilic esophagitis 16 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1058 3.0e-05
cystic fibrosis 1696 1.3e-02
spina bifida 1074 3.0e-02
Disease Target Count Z-score Confidence
Esophagitis 35 5.134 2.6
Allergic hypersensitivity disease 126 3.001 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 2.100 1.3e-02
nasopharyngeal carcinoma -2.300 3.0e-05
spina bifida -3.262 3.0e-02

Gene RIF (3)

AA Sequence

MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGSLLQKLPPRLQ      1 - 70
WKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFW     71 - 140
HYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQSGQVSEALVDFTGGVTM    141 - 210
TINLAEAHGNLWDILIEATYNRTLIGCQTHSGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPW    211 - 280
GKVEWKGDWSDSSSKWELLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTY    281 - 350
TMREGRWEKRSTAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI    351 - 420
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEAHQKSEFVLRV    421 - 490
FSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQNLLNQMTWSSLGSRQPFFSLE    491 - 560
ACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLM    561 - 630
LIRYGGPRLQMDFVSFIHLMLRVENMEDVFQNLTQDGKGIYLQKPEWMMMALYS                    631 - 684
//

Text Mined References (7)

PMID Year Title