Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.41
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 2.100 0.013
nasopharyngeal carcinoma -2.300 0.000
spina bifida -3.262 0.030

Synonym

Accession A8MX76 B3KRU9
Symbols

Gene

Gene RIF (2)

PMID Text
25407941 Eosinophilic esophagitis was associate with increased expression of CAPN14.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of calpain 14 (CAPN14) expression as compared to untreated control

AA Sequence

MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGSLLQKLPPRLQ      1 - 70
WKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFW     71 - 140
HYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQSGQVSEALVDFTGGVTM    141 - 210
TINLAEAHGNLWDILIEATYNRTLIGCQTHSGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPW    211 - 280
GKVEWKGDWSDSSSKWELLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTY    281 - 350
TMREGRWEKRSTAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI    351 - 420
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEAHQKSEFVLRV    421 - 490
FSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQNLLNQMTWSSLGSRQPFFSLE    491 - 560
ACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLM    561 - 630
LIRYGGPRLQMDFVSFIHLMLRVENMEDVFQNLTQDGKGIYLQKPEWMMMALYS                    631 - 684
//

Publication (6)

PMID Year Title
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11675017 2001 Identification and characterization of two novel calpain large subunit genes.
10964513 2000 Gene structure, chromosomal localization, and expression pattern of Capn12, a new member of the calpain large subunit gene family.