Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.41
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Eosinophilic esophagitis 31
Disease Target Count P-value
nasopharyngeal carcinoma 1056 2.9926662569573E-5
cystic fibrosis 1670 0.0132114353363274
spina bifida 1064 0.0297997557705992
Disease Target Count Z-score Confidence
Esophagitis 26 4.696 2.3

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 2.100 0.013
nasopharyngeal carcinoma -2.300 0.000
spina bifida -3.262 0.030

Synonym

Accession A8MX76 B3KRU9
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
25407941 Eosinophilic esophagitis was associate with increased expression of CAPN14.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of calpain 14 (CAPN14) expression as compared to untreated control

AA Sequence

MSLWPPFRCRWKLAPRYSRRASPQQPQQDFEALLAECLRNGCLFEDTSFPATLSSIGSGSLLQKLPPRLQ      1 - 70
WKRPPELHSNPQFYFAKAKRLDLCQGIVGDCWFLAALQALALHQDILSRVVPLNQSFTEKYAGIFRFWFW     71 - 140
HYGNWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQSGQVSEALVDFTGGVTM    141 - 210
TINLAEAHGNLWDILIEATYNRTLIGCQTHSGEKILENGLVEGHAYTLTGIRKVTCKHRPEYLVKLRNPW    211 - 280
GKVEWKGDWSDSSSKWELLSPKEKILLLRKDNDGEFWMTLQDFKTHFVLLVICKLTPGLLSQEAAQKWTY    281 - 350
TMREGRWEKRSTAGGQRQLLQDTFWKNPQFLLSVWRPEEGRRSLRPCSVLVSLLQKPRHRCRKRKPLLAI    351 - 420
GFYLYRMNKYHDDQRRLPPEFFQRNTPLSQPDRFLKEKEVSQELCLEPGTYLIVPCILEAHQKSEFVLRV    421 - 490
FSRKHIFYEIGSNSGVVFSKEIEDQNERQDEFFTKFFEKHPEINAVQLQNLLNQMTWSSLGSRQPFFSLE    491 - 560
ACQGILALLDLNASGTMSIQEFRDLWKQLKLSQKVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQLM    561 - 630
LIRYGGPRLQMDFVSFIHLMLRVENMEDVFQNLTQDGKGIYLQKPEWMMMALYS                    631 - 684
//

Text Mined References (6)

PMID Year Title
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25017104 2014 Genome-wide association analysis of eosinophilic esophagitis provides insight into the tissue specificity of this allergic disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11675017 2001 Identification and characterization of two novel calpain large subunit genes.
10964513 2000 Gene structure, chromosomal localization, and expression pattern of Capn12, a new member of the calpain large subunit gene family.