Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.3e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 4.3e-03

Synonym

Accession A8MX19
Symbols FAM90A12

 Compartment GO Term (1)

AA Sequence

MMARRDPKSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP      1 - 70
ATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS     71 - 140
DYLRVASGPMPVHTSSKRPRLDPILADRSATAMSGRGSVLASLSPLRKASLSSSSSLGPKERQTGAAADM    141 - 210
PQPAVRHEGREPLLVVKPTHSRPEGGCREVPQAASKTHGLPQAARPQAQDKRPAVTSLPCPPAATHSLGL    211 - 280
GSNLSFGPGAKRPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGR    281 - 350
RTPAQVPSVDRQPPHSRPCLPTAQACTMSHHSAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP    351 - 420
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE                              421 - 464
//

Text Mined References (3)

PMID Year Title