Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.400 1.4e-03
Astrocytoma, Pilocytic -1.200 3.2e-05
atypical teratoid / rhabdoid tumor -1.100 1.3e-02
cystic fibrosis 1.079 9.0e-04
ependymoma -1.800 7.9e-09
interstitial cystitis -1.300 5.4e-04
lung adenocarcinoma -1.500 9.2e-08
medulloblastoma, large-cell -1.600 2.8e-04
non-small cell lung cancer -1.719 5.7e-21
Pick disease -1.200 2.1e-03
progressive supranuclear palsy -1.200 2.3e-02
subependymal giant cell astrocytoma -2.102 1.3e-02
tuberculosis -1.200 1.2e-02

Gene RIF (1)

AA Sequence

MLFRARGPVRGRGWGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSSSSRPLPPCQEKDYHFEY      1 - 70
TECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVCSKCGEGTYSLGSGIKFDEWD     71 - 140
ELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIESNRDDCTVSLIYAVHLKKSGYVFFEYQYVD    141 - 210
NNIFFEFFIQNDQCQEMDTTTDKWVKLTDNGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNIT    211 - 280
IEGVAYTSECFPCKPGTFSNKPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKD    281 - 350
YFQIHTPCDEEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD    351 - 420
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAGGSDNDYLILN    421 - 490
LHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKN    491 - 560
ATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKE    561 - 630
TNQCKECPPDTYLSIHQVYGKEACIPCGPGSKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSVGSLMN    631 - 700
GPSFTSKGTKYFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGF    701 - 770
RAALSSQSIILADTFIGVTVETTLKNINIKEDMFPVPTSQIPDVHFFYKSSTATTSCINGRSTAVKMRCN    771 - 840
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYVWNEPKWCIKG    841 - 910
ISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYSKLVMTTNSKECELPAADSC    911 - 980
AIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQLKTSRSPNI                         981 - 1029
//

Text Mined References (10)

PMID Year Title