Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.57
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.69831403959187E-21
ependymoma 2514 7.89820494732256E-9
lung adenocarcinoma 2714 1.97037480727028E-6
pilocytic astrocytoma 3086 2.18174640537323E-5
medulloblastoma, large-cell 6234 2.80974195313557E-4
atypical teratoid/rhabdoid tumor 1095 5.09579554432651E-4
interstitial cystitis 2299 5.39225624999998E-4
cystic fibrosis 1670 8.98835840745716E-4
adult high grade glioma 2148 0.00144188170251752
Pick disease 1893 0.00209627266901953
tuberculosis 1563 0.0119442929890387
subependymal giant cell astrocytoma 2287 0.012892910600769
progressive supranuclear palsy 674 0.022963918026553
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma -1.800 0.000
cystic fibrosis 1.079 0.001
atypical teratoid/rhabdoid tumor -1.300 0.001
medulloblastoma, large-cell -1.600 0.000
tuberculosis -1.200 0.012
non-small cell lung cancer -1.719 0.000
interstitial cystitis -1.300 0.001
lung adenocarcinoma -1.800 0.000
adult high grade glioma -1.400 0.001
pilocytic astrocytoma -1.200 0.000
subependymal giant cell astrocytoma -2.102 0.013
Pick disease -1.200 0.002
progressive supranuclear palsy -1.200 0.023

Synonym

Accession A8MWY0 A4D1C9 B4DJV3 Q17RI6 Q96DP2
Symbols EIG121L

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 CSPA Cell Line (2)

Pathway (1)

Gene RIF (1)

PMID Text
17475571 Similar to EIG121L gene, expressed in various organs of Xenopus during development.

AA Sequence

MLFRARGPVRGRGWGRPAEAPRRGRSPPWSPAWICCWALAGCQAAWAGDLPSSSSRPLPPCQEKDYHFEY      1 - 70
TECDSSGSRWRVAIPNSAVDCSGLPDPVRGKECTFSCASGEYLEMKNQVCSKCGEGTYSLGSGIKFDEWD     71 - 140
ELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPRGNYIESNRDDCTVSLIYAVHLKKSGYVFFEYQYVD    141 - 210
NNIFFEFFIQNDQCQEMDTTTDKWVKLTDNGEWGSHSVMLKSGTNILYWRTTGILMGSKAVKPVLVKNIT    211 - 280
IEGVAYTSECFPCKPGTFSNKPGSFNCQVCPRNTYSEKGAKECIRCKDDSQFSEEGSSECTERPPCTTKD    281 - 350
YFQIHTPCDEEGKTQIMYKWIEPKICREDLTDAIRLPPSGEKKDCPPCNPGFYNNGSSSCHPCPPGTFSD    351 - 420
GTKECRPCPAGTEPALGFEYKWWNVLPGNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAGGSDNDYLILN    421 - 490
LHIPGFKPPTSMTGATGSELGRITFVFETLCSADCVLYFMVDINRKSTNVVESWGGTKEKQAYTHIIFKN    491 - 560
ATFTFTWAFQRTNQGQDNRRFINDMVKIYSITATNAVDGVASSCRACALGSEQSGSSCVPCPPGHYIEKE    561 - 630
TNQCKECPPDTYLSIHQVYGKEACIPCGPGSKNNQDHSVCYSDCFFYHEKENQSLHYDFSNLSSVGSLMN    631 - 700
GPSFTSKGTKYFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGF    701 - 770
RAALSSQSIILADTFIGVTVETTLKNINIKEDMFPVPTSQIPDVHFFYKSSTATTSCINGRSTAVKMRCN    771 - 840
PTKSGAGVISVPSKCPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACKRGFQETLYVWNEPKWCIKG    841 - 910
ISLPEKKLATCETVDFWLKVGAGVGAFTAVLLVALTCYFWKKNQKLEYKYSKLVMTTNSKECELPAADSC    911 - 980
AIMEGEDNEEEVVYSNKQSLLGKLKSLATKEKEDHFESVQLKTSRSPNI                         981 - 1029
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21177533 2011 A transmembrane protein EIG121L is required for epidermal differentiation during early embryonic development.
17475571 2007 Expression of estrogen induced gene 121-like (EIG121L) during early Xenopus development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.