Knowledge Summary

Patent

No data available

 Compartment GO Term (1)

AA Sequence

MLCPCIQESTFETCLFMAVSQMSKWRLSRVGGSRSLPAEMEVLGEVWCVRAEEQPMTGLGIVWHSPLLDK      1 - 70
ALETWSLQQQPDFSLGLGHLGLGTDATWMQSFPGSGGDAQAGTGVSGLLRLYPNLLCDFGPRQGPLWALL     71 - 140
LEKRQMAGTGGSPALLAWRSASWRALG                                               141 - 167
//

Text Mined References (3)

PMID Year Title