Knowledge Summary

Patent

No data available

Synonym

Accession A8MWP4
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MQRPHRRQSQMDAASTRAPPRPSAPQQGRRQPSMPGSAQCHHRPDPHPPAPGKKKSSPVGRFFPASAMAP      1 - 70
PWLPGIVSAAQLKPVLSDLPPHCTRAQCQPLTQRPHSLHLQDSRNASSLPHKGWRCNFPLQGPAGLTHKS     71 - 140
ACVGRMGHCCGSAGNVPELSPRPASPRGQQVTQDGPLQTPELPSECNVGPVMSRQPFPEQSQQGECAIDP    141 - 210
RGPPRLELSWGEDPLSGV                                                        211 - 228
//

Text Mined References (1)

PMID Year Title
10830953 2000 The DNA sequence of human chromosome 21.