Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.80

Knowledge Summary

Patent

No data available

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGRAPSLAAGLLFGSLAGVGAYQLYQDPRNVWDFLAAT      1 - 70
SVTFVGIMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD                               71 - 114
//

Text Mined References (1)

PMID Year Title