Knowledge Summary

Patent

No data available

Synonym

Accession A8MWL6
Symbols

Gene

AA Sequence

MESGAYGVAEAGGSFDLRPFLTQPQVVARALCLVFALIVFSCIYGEGYSNTHKSKQMYCVFNHNEDACRY      1 - 70
GSAIGVLAFLASAFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTDPEDVLVG     71 - 140
ADSARAAITFSFFSIFSWGVLASLTYQRYKAGVDDFIQNYVDPSPDPNTAYASYPGASVDNYQQPPFTQN    141 - 210
AETTEGYQPPPVY                                                             211 - 223
//

Publication (2)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
9760194 1998 Characterization of the human synaptogyrin gene family.