Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.27
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sensory peripheral neuropathy 10 3.522 1.8

Expression

AA Sequence

MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGA      1 - 70
LGMDAFIKAMKKVLSSVSDEMLKELFLKVDSDCEGFVTWQKYVDYMMREFQGKEDMRKSQYRLHFYLPMT     71 - 140
VVPL                                                                      141 - 144
//

Text Mined References (1)

PMID Year Title