Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.27
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sensory peripheral neuropathy 5 3.468 1.7

Expression

Synonym

Accession A8MWE9
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGA      1 - 70
LGMDAFIKAMKKVLSSVSDEMLKELFLKVDSDCEGFVTWQKYVDYMMREFQGKEDMRKSQYRLHFYLPMT     71 - 140
VVPL                                                                      141 - 144
//

Text Mined References (1)

PMID Year Title
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.