Property Summary

NCBI Gene PubMed Count 3
Grant Count 200
R01 Count 134
Funding $21,829,071.5
PubMed Score 1.33

Knowledge Summary

Patent

No data available

Synonym

Accession A8MWD9
Symbols

Gene

 GO Function (1)

AA Sequence

MSKAHPPELKKFTDKKFSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQKNIGMVEIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.