Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.33

Knowledge Summary

Patent

No data available

 GO Function (1)

AA Sequence

MSKAHPPELKKFTDKKFSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQKNIGMVEIRGNSIIML      1 - 70
EALERV                                                                     71 - 76
//

Text Mined References (3)

PMID Year Title