Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
26929373 Both transfected and endogenous beclin 2 coimmunoprecipitated with vGPCR. Beclin 2 overexpression decreased HA-vGPCR steady-state levels. It regulates vGPCR levels by a lysosomal degradation pathway.
26506105 distinct patterns of Beclin 1 and Beclin 2 were associated with aggressive clinical outcomes. Beclin 1 overexpression, as well as Beclin 2 overexpression and depletion, contributed to tumor growth.
23954414 Study identified a previously uncharacterized mammalian-specific protein, Beclin 2, which, like Beclin 1, functions in autophagy and interacts with class III PI3K complex components.[Beclin 2]

AA Sequence

MSSIRFLCQRCHQALKLSGSSESRSLPAAPAPTSGQAEPGDTREPGVTTREVTDAEEQQDGASSRSPPGD      1 - 70
GSVSKGHANIFTLLGELGAMHMLSSIQKAAGDIFDIVSGQAVVDHPLCEECTDSLLEQLDIQLALTEADS     71 - 140
QNYQRCLETGELATSEDEAAALRAELRDLELEEARLVQELEDVDRNNARAAADLQAAQAEAAELDQQERQ    141 - 210
HYRDYSALKRQQLELLDQLGNVENQLQYARVQRDRLKEINCFTATFEIWVEGPLGVINNFRLGRLPTVRV    211 - 280
GWNEINTAWGQAALLLLTLANTIGLQFQRYRLIPCGNHSYLKSLTDDRTELPLFCYGGQDVFLNNKYDRA    281 - 350
MVAFLDCMQQFKEEAEKGELGLSLPYGIQVETGLMEDVGGRGECYSIRTHLNTQELWTKALKFMLINFKW    351 - 420
SLIWVASRYQK                                                               421 - 431
//

Text Mined References (4)

PMID Year Title
26929373 2016 Endolysosomal trafficking of viral G protein-coupled receptor functions in innate immunity and control of viral oncogenesis.
26506105 2015 Expression of Beclin Family Proteins Is Associated with Tumor Progression in Oral Cancer.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.