Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.23
PubTator Score 47.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.800 4.5e-04
head and neck cancer and chronic obstruc... -1.400 3.3e-02
intraductal papillary-mucinous carcinoma... 4.900 2.0e-03
lung carcinoma 2.400 1.1e-14
non-small cell lung cancer -1.700 4.2e-02
osteosarcoma -2.388 1.2e-03
pituitary cancer -2.700 3.0e-07
psoriasis -1.800 1.7e-11
ulcerative colitis -2.200 3.5e-04

Gene RIF (1)

AA Sequence

MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLF      1 - 70
ERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQV     71 - 140
TVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVT    141 - 210
KEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTY    211 - 280
SWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLS    281 - 350
PLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV    351 - 420
SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE                                421 - 462
//

Text Mined References (13)

PMID Year Title