Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.73
PubTator Score 47.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -2.388 0.001
intraductal papillary-mucinous carcinoma... 4.900 0.002
Breast cancer -1.800 0.000
lung carcinoma 2.400 0.000
ulcerative colitis -2.200 0.000
pituitary cancer -2.700 0.000
head and neck cancer and chronic obstruc... -1.400 0.033
non-small cell lung cancer -1.700 0.042
psoriasis -1.800 0.000

Synonym

Accession A8MVW5 B3KTT4 B4DPJ1 B9EG93 E9PDV5 Q6UXI0
Symbols MIKI

Gene

Gene RIF (1)

PMID Text
22864114 The data suggest that PARsylation of Miki by tankyrase-1 is a key initial event promoting prometaphase.

AA Sequence

MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTPASDIQIIWLF      1 - 70
ERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNYIVKVNIQGNGTLSASQKIQV     71 - 140
TVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAYQWLKNGRPVHTSSTYSFSPQNNTLHIAPVT    141 - 210
KEDIGNYSCLVRNPVSEMESDIIMPIIYYGPYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTY    211 - 280
SWIRRTDNTTYIIKHGPRLEVASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSVGLEKLAQKGKSLS    281 - 350
PLASITGISLFLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQTFSGHEDALDDFGIYEFVAFPDV    351 - 420
SGVSRIPSRSVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE                                421 - 462
//

Publication (13)

PMID Year Title
25110502 2014 Effects of smoking cessation on gene expression in human leukocytes of chronic smoker.
22864114 2012 Poly-ADP ribosylation of Miki by tankyrase-1 promotes centrosome maturation.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20425829 2010 Myoclonus dystonia plus syndrome due to a novel 7q21 microdeletion.
19358830 2009 Identification of a common microdeletion cluster in 7q21.3 subband among patients with myeloid leukemia and myelodysplastic syndrome.
19284880 2009 Identification of candidate genes for human pituitary development by EST analysis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...