Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MVS5 B2RXI3
Symbols HIDE1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPWTILLFAAGSLAIPAPSIRLVPPYPSSQEDPIHIACMAPGNFPGANFTLYRGGQVVQLLQAPTDQRGV      1 - 70
TFNLSGGSSKAPGGPFHCQYGVLGELNQSQLSDLSEPVNVSFPVPTWILVLSLSLAGALFLLAGLVAVAL     71 - 140
VVRKVKLRNLQKKRDRESCWAQINFDSTDMSFDNSLFTVSAKTMPEEDPATLDDHSGTTATPSNSRTRKR    141 - 210
PTSTSSSPETPEFSTFRACQ                                                      211 - 230
//

Text Mined References (3)

PMID Year Title