Knowledge Summary

Patent

No data available

Synonym

Accession A8MVM7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MDKIRHTEADIFKNGSKRMIATVPLRHSIRDRKPSLHFLHSLASSSSLIYRNALLHKSYKLHLQKNKSQK      1 - 70
EKHRHSKMKIAYKDTPRNRLSRNAKKCLEDNKLVPISEVSLDPIISSNPLLRWWATSASNDSLLEELNNR     71 - 140
FEQITNAWVQVSGDEAENCIHKKREHIENDHFKVASPLETCLLELEVSPVKMLFQKKYDLNELCTWFMQT    141 - 210
TETQSLSLVRKANARNPLEVINTRGIKLGTKYSDFNASPFRKHFKKFALSSPSKSAEKLHILHKVANSPL    211 - 280
LNVKSNLAIARLKRTEFKRLHHERWKREGKLHNHGTVDWNSKRRNLRFFCQNQFLNKTEGETNADIPLQG    281 - 350
KSIVDNQCVLPPEIRGDLQQRVVMPDFKIHASFENKFKSEAKENGTNCSQKDFQKGPRLENVCPNSWRSK    351 - 420
TLKDCRIFLRKLNCLEHRNTFKLNTIIYSPESTDSGNTHQTHMEESKRFTLRSHSARQNSFKKQSKEIEN    421 - 490
ANTNNPSADEFADHLGNSKLSKCVNFDKNPDSFEVLSNLNKRKRPPWKITEMSTKRHKRQSCNSGQMANY    491 - 560
FSKSLVSKIFGQPNFLAPSMKLVKLGAAKCTSALPHLLICPGFHTNKNIYSRDIEIIFKIYYFNNVDVIS    561 - 630
FCIW                                                                      631 - 634
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.