Knowledge Summary

Patent

No data available

Synonym

Accession A8MVJ9
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVGGGWKRRPGAGAGPQCEKTVDVKKSKFCEADVSSDLRKEVENHYTLSLPEDFYHFWKFCEELDSEKPA      1 - 70
DPLSASLGLQLVDPYNILAGKHKMKKKSTVPNFNLHWRFYYDPPEFQTIIIRDKLSATWGISDRDSPDEL     71 - 140
PVYVGINEAKKNCIIVPNGDNVFAAVKLYLMKKLKEVTDKKKTNLFKNVDEKLTETARELGYSLEQRTMK    141 - 210
MKQRDKKVVTKTFHGTGLVPPVDKNVVGYRELPETDADLKRICKTIVEAASDDERRKAFAPIQEMMTFVQ    211 - 280
FANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLPLAYNLLKRNLFAEIMKDHLANRRKENIDQFAA       281 - 347
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.