Property Summary

NCBI Gene PubMed Count 3
Grant Count 1
Funding $36,000
PubMed Score 3.39

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSSDNQWSADEDEGQLSRLIRKSRDSPFVPIGIAGFVTVVSCGLYKLKYRRDQKMSIHLIHMRVAAQGFV      1 - 70
VGAVTLGVLYSMYKDYIRPRFFSESKK                                                71 - 97
//

Text Mined References (3)

PMID Year Title
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
16541075 2006 The finished DNA sequence of human chromosome 12.
15869325 2005 A scan for positively selected genes in the genomes of humans and chimpanzees.