Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.17
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPPFLITLFLFHSCCLRANGHLREGMTLLKTEFALHLYQSVAACRNETNFVISPAGVSLPLEILQFGAEG      1 - 70
STGQQLADALGYTVHDKRVKDFLHAVYATLPTSSQGTEMELACSLFVQVGTPLSPCFVEHVSWWANSSLE     71 - 140
PADLSEPNSTAIQTSEGASRETAGGGPSEGPGGWPWEQVSAAFAQLVLVSTMSFQGTWRKRFSSTDTQIL    141 - 210
PFTCAYGLVLQVPMMHQTTEVNYGQFQDTAGHQVGVLELPYLGSAVSLFLVLPRDKDTPLSHIEPHLTAS    211 - 280
TIHLWTTSLRRARMDVFLPRFRIQNQFNLKSILNSWGVTDLFDPLKANLKGISGQDGFYVSEAIHKAKIE    281 - 350
VLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYPLKN    351 - 420
KHSF                                                                      421 - 424
//

Text Mined References (3)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
15057823 2004 The DNA sequence and analysis of human chromosome 13.