Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MUP2 B7Z4C1
Symbols U99HG
CS-KMT
METTL12

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAALRRMLHLPSLMMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYDEVQGLLLPLLQE      1 - 70
AQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHF     71 - 140
MHADAQNLGAVASSGSFQLLLDKGTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLE    141 - 210
QGSYGWTVTVQELGPFRGITYFAYLIQGSH                                            211 - 240
//

Text Mined References (9)

PMID Year Title