Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary


No data available



Accession A8MUP2 B7Z4C1
Symbols U99HG


  Ortholog (5)

Species Source
Chimp OMA EggNOG
Horse OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

QGSYGWTVTVQELGPFRGITYFAYLIQGSH                                            211 - 240

Text Mined References (7)

PMID Year Title
25023281 2014 Human METTL20 methylates lysine residues adjacent to the recognition loop of the electron transfer flavoprotein in mitochondria.
17154719 2006 Mammalian small nucleolar RNAs are mobile genetic elements.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.