Knowledge Summary

Patent

No data available

Synonym

Accession A8MUN3
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MSFEYRHYKREAKICTCRGGWAHVLLCIGVSQGACAEHLPHRPAVEKDVPGAGEVLFMCSWRIFPVASAS      1 - 70
PSSSISGLAGHSVFLVPGLAAHPGSHSDQPPGVPSRRKSRLERWSPSVSRSTSPPTEAPFCL             71 - 132
//

Text Mined References (1)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.