Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.0e-09

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.947 3.0e-09

Synonym

Accession A8MUL3
Symbols C10orf109
NCRNA00168

 Compartment GO Term (0)

AA Sequence

MKQLFPPPPGTSLTHALGAWRGRERAQAATSLLASSASQFPTAVEDALMSVLTSHCAPSTPAATRAQQTG      1 - 70
TRGHIHPACPCQQSCVGASRPPGRPQIFLPLTTALSLEAYAADTCSAADFLHNPSSWGKVWYLNEASFDL     71 - 140
YSYHYFW                                                                   141 - 147
//

Text Mined References (4)

PMID Year Title