Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession A8MUL3
Symbols C10orf109
NCRNA00168
bA466B20.1

Gene

 Compartment GO Term (0)

AA Sequence

MKQLFPPPPGTSLTHALGAWRGRERAQAATSLLASSASQFPTAVEDALMSVLTSHCAPSTPAATRAQQTG      1 - 70
TRGHIHPACPCQQSCVGASRPPGRPQIFLPLTTALSLEAYAADTCSAADFLHNPSSWGKVWYLNEASFDL     71 - 140
YSYHYFW                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11181995 2001 The sequence of the human genome.