Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

SSTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ                                  491 - 530

Text Mined References (18)

PMID Year Title