Knowledge Summary

Patent

No data available

Synonym

Accession A8MUA0
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRLCLIPWNTGTPQRVLPPVVWSPPSRKKPVLSARNSRMFGYLSPVRIPRLRGKFNLQLPSLDEQVIPAR      1 - 70
LPKMEVRAEEPKEATEVKDQVQTQEQEDNKRGPCSNGEAASTSRPLETQGNLTSSWYNPRPLEGNVHLKS     71 - 140
LTENNQTDKAQVHAVSFYSKGHGVASSHSPAGGILPFGKPDPLPTVLPAPVPGCSLWPEKAALKVLGKDH    141 - 210
LPSSPGLLTVGEDMQPKDPAALGSSRSSPPRAAGHRSRKRKLSGPPLQLQPTPPLQLRWERDERPPPAKL    211 - 280
PCLSPEALLVGQASQREGRLQQGNMRKNMRVLSRTSKFRRLRQLLRRRKKRQQVRSISACT             281 - 341
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.