Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MU93
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MASARGAKQSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRH      1 - 70
VESSSQRTETTSRHVRASSLRVETSLHCAESPTPRPSRPPARTKKRPDEMLLPKGHQGARALSQDRKASS     71 - 140
CQPASQLPGGPIIFGFMETNHKSM                                                  141 - 164
//

Text Mined References (4)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.