Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.32
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 2.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy -1.483 2.0e-03

Gene RIF (2)

AA Sequence

MEQKEGKLSEDGTTVSPAADNPEMSGGGAPAEETKGTAGKAINEGPPTESGKQEKAPAEDGMSAELQGEA      1 - 70
NGLDEVKVESQREAGGKEDAEAELKKEDGEKEETTVGSQEMTGRKEETKSEPKEAEEKESTLASEKQKAE     71 - 140
EKEAKPESGQKADANDRDKPEPKATVEEEDAKTASQEETVVEDEAKAEPKEPDGKEEAKHGAKEEADEPG    141 - 210
SPSEEQEQDVEKEPEGGAGVIPSSPEEWPESPTGEGHNLSTDGLGPDCVASGQTSPSASESSPSDVPQSP    211 - 280
PESPSSGEKKEKAPERRVSAPARPRGPRAQNRKAIVDKFGGAASGPTALFRNTKAAGAAIGGVKNMLLEW    281 - 350
CRAMTKKYEHVDIQNFSSSWSSGMAFCALIHKFFPDAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLD    351 - 420
VDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK                                     421 - 457
//

Text Mined References (9)

PMID Year Title