Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MTZ7
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MAYSSSNSDIEDDSSKSNSNLSLSVGYFPCEDTPCEDTTSWEDAPSKGPSIHFLPPVQGAWGTERIGRRM      1 - 70
KRQDQIQDEPEQFCKLSIFLAWDVDIGSDNTDSRANRLLNGDNLWIDKLPKERTKLSVGKLNNLVQEFQI     71 - 140
FLENLKDDDAVFPETAQQDFQLSSGSPPEMVQMISQATASQRTSAPEISSILSEQPEKDDTPSHTQAQCC    141 - 210
LNFGWAFSWLRQRILPSLLRRDHPVNATKSPHRSAPTKRLFHRGKRIQPQETLELGHPI               211 - 269
//

Text Mined References (2)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
11181995 2001 The sequence of the human genome.