Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.13
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -1.400 6.2e-07
colon cancer -1.400 2.2e-04
intraductal papillary-mucinous adenoma (... -1.300 5.2e-03
intraductal papillary-mucinous carcinoma... -1.600 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.200 4.7e-02
osteosarcoma -3.417 2.0e-09
ovarian cancer -1.900 1.1e-09
pancreatic cancer -1.100 1.9e-05
posterior fossa group B ependymoma 1.100 2.1e-04
progressive supranuclear palsy -1.200 5.6e-03
psoriasis -1.100 1.2e-03
tuberculosis -1.400 3.1e-07
ulcerative colitis -1.400 4.5e-06

Gene RIF (1)

AA Sequence

MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMH      1 - 70
QAAQNTIRQQEMAEKDQRQITH                                                     71 - 92
//

Text Mined References (9)

PMID Year Title