Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.100 0.000

AA Sequence

MGPLTFMDVAIEFSVEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQGKEPWNMERHEM      1 - 70
VAKPPGMCCYFAQDLRPEQSIKASLQRIILRKYEKCGHHNLQLKKGYKSVDEYKVHKGSYNGFNQCLTTT     71 - 140
QSKIFQCDKYVKDFHKFSNSNRHKTEKNPFKCKECGKSFCVLSHLTQHKRIHTTVNSYKLEECGKAFNVS    141 - 210
STLSQHKRIHTGQKHYKCEECGIAFNKSSHLNTHKIIHTGEKSYKREECGKAFNISSHLTTHKIIHTGEN    211 - 280
AYKCKECGKAFNQSSTLTRHKIIHAGEKPYICEHCGRAFNQSSNLTKHKRIHTGDKPYKCEECGKAFNVS    281 - 350
STLTQHKRIHTGEKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCEECGKAFNTSSHLTTHKRIHTGEK    351 - 420
PYKCEECGKAFNQFSQLTTHKIIHTGEKPYKCKECGKAFKRSSNLTEHRIIHTGEKPYKCEECGKAFNLS    421 - 490
SHLTTHKKIHTGEKPYKCKECGKAFNQSSTLARHKIIHAGEKPYKCEECGKAFYQYSNLTQHKIIHTGEK    491 - 560
PYKCEECGKAFNWSSTLTKHKVIHTGEKPYKCKECGKAFNQCSNLTTHKKIHAVEKSDK               561 - 619
//

Text Mined References (3)

PMID Year Title
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.