Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma -2.100 0.042
osteosarcoma 1.869 0.000
aldosterone-producing adenoma -1.280 0.005

AA Sequence

MARTLEPLAKKIFKGVLVAELVGVFGAYFLFSKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIREL      1 - 70
DQKTWLNSKN                                                                 71 - 80
//

Text Mined References (5)

PMID Year Title
25002142 2014 Proteomic mapping of the human mitochondrial intermembrane space in live cells via ratiometric APEX tagging.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.