Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
aldosterone-producing adenoma 665 4.7e-03
oligodendroglioma 2850 4.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma -1.280 4.7e-03
oligodendroglioma -1.800 4.1e-02
osteosarcoma 1.869 1.5e-06

Synonym

Accession A8MTT3 A8MUR5
Symbols CEBPZ-AS1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MARTLEPLAKKIFKGVLVAELVGVFGAYFLFSKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIREL      1 - 70
DQKTWLNSKN                                                                 71 - 80
//

Text Mined References (5)

PMID Year Title