Property Summary

NCBI Gene PubMed Count 2
PubMed Score 209.22
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Diphyllobothriasis 6 3.543 1.8

Expression

AA Sequence

MPSPRPRGSPPPAPSGSRVRPPRSGRSPAPRSPTGPNTPRAPGRFESPFSVEAILARPDPCAPAASQPSG      1 - 70
SACVHPAFWTAASLCATGGLPWACPTSWLPAYLSVGFYPVPGPRVAPVCGLLGFGVTGLELAHCSGLWAF     71 - 140
PDWAPTEDLQDTERQQKRVRTMFNLEQLEELEKVFAKQHNLVGKKRAQLAARLKLTENQVRVWFQNRRVK    141 - 210
YQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAESGVDG                                 211 - 251
//

Text Mined References (3)

PMID Year Title