Property Summary

NCBI Gene PubMed Count 3
PubMed Score 15.27
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Plague 19 5.809 2.9

Synonym

Accession A8MTL9
Symbols ACC6
ACC-6
HSMD-v
C18orf53

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGFQSLLVAINRTDTEYVLRTANGLFGEKSY      1 - 70
DFLTGFTDSCGKFYQATIKQLDFVNDTEKSTTRVNSWVADKTKGENILLFYFDNILNSFIVSSLQNCQI      71 - 139
//

Text Mined References (3)

PMID Year Title