Property Summary

NCBI Gene PubMed Count 3
PubMed Score 12.77
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Plague 19 5.363 2.7

Expression

AA Sequence

MSISSALAMVFMGAKGNTAAQMSQALCFSKIGGEDGDIHRGFQSLLVAINRTDTEYVLRTANGLFGEKSY      1 - 70
DFLTGFTDSCGKFYQATIKQLDFVNDTEKSTTRVNSWVADKTKGENILLFYFDNILNSFIVSSLQNCQI      71 - 139
//

Text Mined References (3)

PMID Year Title
17409267 2007 Alternative splicing due to an intronic SNP in HMSD generates a novel minor histocompatibility antigen.
16177791 2005 DNA sequence and analysis of human chromosome 18.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.