Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.35

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDWFHCNQCFRKDGAHFFVTSCGHIFCKKCVTLEKCAVCGTACKHLALSDNLKPQEKMFFKSPVETALQY      1 - 70
FSHISQVWSFQKKQTDLLIAFYKHRITKLETAMQEAQQALVSQDKELSVLRKENGELKKFLAILKESPSR     71 - 140
YQGSRSITPRPVGITSPSQSVTPRPSFQHSSQVVSRSSSAESIPYREAGFGSLGQGGRGLQGRRTPRDSY    141 - 210
NETPSPASTHSLSYRTSSASSGQGIFSFRPSPNGHSGHTRVLTPNNFAQRESTTTLESLPSFQLPVLQTL    211 - 280
YQQRRHMGLPSGREAWTTSR                                                      281 - 300
//

Text Mined References (2)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11181995 2001 The sequence of the human genome.