Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.35

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MTL3
Symbols C14orf164

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Platypus OMA EggNOG

AA Sequence

MDWFHCNQCFRKDGAHFFVTSCGHIFCKKCVTLEKCAVCGTACKHLALSDNLKPQEKMFFKSPVETALQY      1 - 70
FSHISQVWSFQKKQTDLLIAFYKHRITKLETAMQEAQQALVSQDKELSVLRKENGELKKFLAILKESPSR     71 - 140
YQGSRSITPRPVGITSPSQSVTPRPSFQHSSQVVSRSSSAESIPYREAGFGSLGQGGRGLQGRRTPRDSY    141 - 210
NETPSPASTHSLSYRTSSASSGQGIFSFRPSPNGHSGHTRVLTPNNFAQRESTTTLESLPSFQLPVLQTL    211 - 280
YQQRRHMGLPSGREAWTTSR                                                      281 - 300
//

Text Mined References (2)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.
11181995 2001 The sequence of the human genome.