Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MTL0
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MGPEEKTIMTERSAAVFIQAWWRGMLVRRTLLHAALRAWIIQCWWRQVLEKLLAKRRRMVLEFYVQQEWA      1 - 70
AVRLQSWVRMWCVRQRYCRLLNAVRIIQVYWRWHSCHSRVFIEGHYELKENQLNIQLEISLGLQACKVQQ     71 - 140
CIPLPLKE                                                                  141 - 148
//

Text Mined References (2)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.