Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.01552968995697E-10

Synonym

Accession A8MTJ6 B5RI09
Symbols

Gene

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MALYCGDNFGVYSQPGLPPPAATAAAPGAPPAARAPYGLADYAAPPAAAANPYLWLNGPGVGGPPSAAAA      1 - 70
AAAAYLGAPPPPPPPGAAAGPFLQPPPAAGTFGCSQRPFAQPAPAAPASPAAPAGPGELGWLSMASREDL     71 - 140
MKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFPFYQRSKAGWQNSIRHNLSLNDCFKKVPRDE    141 - 210
DDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSEASNGSTVAAGTSKSEEGLSSGLGSGVGGKPEEESPST    211 - 280
LLRPSHSPEPPEGTKSTASSPGGPMLTSTPCLNTFFSSLSSLSVSSSVSTQRALPGSRHLGIQGAQLPSS    281 - 350
GVFSPTSISEASADTLQLSNSTSNSTGQRSSYYSPFPASTSGGQSSPFSSPFHNFSMVNSLIYPREGSEV    351 - 420
//

Text Mined References (2)

PMID Year Title
18787161 2008 A mutation in hairless dogs implicates FOXI3 in ectodermal development.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.