Property Summary

NCBI Gene PubMed Count 21
Grant Count 153
R01 Count 102
Funding $17,681,870.14
PubMed Score 179.54
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Male infertility 170

Synonym

Accession A8MTJ3 A4D1B2 A4D1B3 B9EJG5
Symbols GDCA

Gene

Gene RIF (6)

PMID Text
22456541 (GNAT3, 11 SNPs) gene, located within the 1-LOD support interval region for their association with MS and its related traits. Several SNPs were associated with MS and its related traits. Remarkably.
21324568 The sweet taste receptors (alpha-gustducin and T1R3) are involved in glucose-stimulated secretion of GLP-1 and PYY.
20858777 Observational study of gene-disease association. (HuGE Navigator)
20660057 Observational study of gene-disease association. (HuGE Navigator)
17021831 Axonemal-associated localization within the midpiece and principal piece of human spermatozoa raises the possibility that this G protein alpha-subunit may process intracellular signals controlling sperm motility.
16728727 the alpha-subunit of the taste-specific G protein gustducin is expressed prominently in cells of the human colon

AA Sequence

MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFK      1 - 70
AVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACF     71 - 140
ERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKK    141 - 210
WIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTK    211 - 280
VHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD    281 - 350
CGLF                                                                      351 - 354
//

Text Mined References (22)

PMID Year Title
26400924 2015 Immunohistochemical Analysis of Human Vallate Taste Buds.
25990784 2015 Expression of umami-taste-related genes in the tongue: a pilot study for genetic taste diagnosis.
22977065 2012 Genetic analysis of chemosensory traits in human twins.
22456541 2012 Metabolic syndrome is linked to chromosome 7q21 and associated with genetic variants in CD36 and GNAT3 in Mexican Americans.
21324568 2011 The functional involvement of gut-expressed sweet taste receptors in glucose-stimulated secretion of glucagon-like peptide-1 (GLP-1) and peptide YY (PYY).
20858777 2010 Taste genes associated with dental caries.
20660057 2010 Association between common variation in genes encoding sweet taste signaling components and human sucrose perception.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17724332 2007 T1R3 and gustducin in gut sense sugars to regulate expression of Na+-glucose cotransporter 1.
17724330 2007 Gut-expressed gustducin and taste receptors regulate secretion of glucagon-like peptide-1.
More...