Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.83

Knowledge Summary

Patent

No data available

AA Sequence

MDLSRPRWSLWRRVFLMASLLACGICQASGQIFITQTLGIKGYRTVVALDKVPEDVQEYSWYWGANDSAG      1 - 70
NMIISHKPPSAQQPGPMYTGRERVNREGSLLIRPTALNDTGNYTVRVVAGNETQRATGWLEVLELGSNLG     71 - 140
ISVNASSLVENMDSVAADCLTNVTNITWYVNDVPTSSSDRMTISPDGKTLVILRVSRYDRTIQCMIESFP    141 - 210
EIFQRSERISLTVAYGPDYVLLRSNPDDFNGIVTAEIGSQVEMECICYSFLDLKYHWIHNGSLLNFSDAK    211 - 280
MNLSSLAWEQMGRYRCTVENPVTQLIMYMDVRIQAPHEDLTCCPQRFLHLRIHGDVPHHADSAGWRLHLW    281 - 350
SPDPCSDQPLLNQDKSGSMSVHPRPEDKTRRASR                                        351 - 384
//

Text Mined References (2)

PMID Year Title
16139472 2005 Identification of a novel group of evolutionarily conserved members within the rapidly diverging murine Cea family.
15057824 2004 The DNA sequence and biology of human chromosome 19.