Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.83

Knowledge Summary


No data available

AA Sequence

SPDPCSDQPLLNQDKSGSMSVHPRPEDKTRRASR                                        351 - 384

Text Mined References (2)

PMID Year Title