Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.29

Knowledge Summary

Patent

No data available

AA Sequence

MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAKDRMAGAPMAAAVQPAEVTVEVGEDLHMHHVRDR      1 - 70
EMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTASQHYLTMT     71 - 140
IISVTLEIPHHITQRDADRSLSIPDEQLTHLRHSSFCSTQVSTVHITKNRNGGGSLNNYSSSIPSTPSTS    141 - 210
QEDPQFSVPPTANTPTPVCKWSMCWSNLFTSEKGSHPDKERKAPENHADTIGSSRAIPIKQGMLLKRSGK    211 - 280
WLKTWKKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKSNGLSK    281 - 350
DMDTGLGDSICFSPSISSTTSPKLNLPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWV    351 - 420
QAIQSQIVASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECSGI    421 - 490
HCSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSVKSTREEKERWIRSKYEKKL    491 - 560
FLAPLPCTELSLGQHLLRATADEDLQTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLAQLLIW    561 - 630
YRVDVMARDAHGNTALTYARQASSQECINVLLQYGCPDECV                                 631 - 671
//

Text Mined References (1)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.