Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.70
PubTator Score 27.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.5e-09
lung adenocarcinoma 2716 1.3e-08
Breast cancer 3577 1.5e-05
psoriasis 6694 2.7e-04
invasive ductal carcinoma 2950 3.3e-04
lung cancer 4740 1.4e-03
Disease Target Count Z-score Confidence
Fanconi anemia 56 4.705 2.4

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 1.5e-05
invasive ductal carcinoma 1.700 3.3e-04
lung adenocarcinoma 1.100 1.3e-08
lung cancer 1.200 1.4e-03
psoriasis 1.800 2.7e-04
tuberculosis 1.500 1.5e-09

 GO Function (1)

Gene RIF (10)

AA Sequence

MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQL      1 - 70
EKVLPQLLLDF                                                                71 - 81
//

Text Mined References (19)

PMID Year Title