Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 5
Funding $1,487,355.8
PubMed Score 5.02
PubTator Score 27.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.800 0.000
tuberculosis 1.500 0.000
lung cancer 1.700 0.000
lung adenocarcinoma 1.100 0.000
invasive ductal carcinoma 1.700 0.000
Breast cancer 1.100 0.000

Synonym

Accession A8MT69 O00281 O00282 Q96DD4 Q96F51 CENP-X
Symbols D9
MHF2
CENP-X
FAAP10
STRA13

Gene

PDB

4DRA   4DRB   4E44   4E45   4NDY   4NE1   4NE3   4NE5   4NE6  

 GO Function (1)

Gene RIF (10)

PMID Text
24699063 The MHF complex, which is a heterotetramer that comprises two MHF1-MHF2 heterodimers, is remodeled by FANCM to favor recognition of branched DNA over dsDNA.
24522885 CENPX assembly in living human cells, revealing a window in S phase and G2 in which de novo assembly of the complex from a soluble precursor occurs through a dynamic exchange mechanism.
24390579 MHF prefers branched DNA over dsDNA because it engages two duplex arms. MHF engages DNA forks or various four-way junctions independent of the junction-site structure. The DNA-binding interface of MHF is important for cellular resistance to DNA damage.
24256282 It discusses current knowledge of the biological roles of CENP-S and CENP-X and how their dual existence may be a common feature of CCAN (constitutive centromere-associated network) proteins.
23886707 A long, positively charged patch exposed on the surface of the (MHF1-MHF2) complex plays a critical role in double-stranded DNA binding to chromatin.
22510687 MHF1 and MHF2 form a compact tetramer to which FANCM-F binds through a 'dual-V' shaped structure.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20347429 provide biochemical evidence that MHF1 and MHF2 assemble into a heterodimer that binds DNA and enhances the DNA branch migration activity of FANCM.
19620631 Results identified a centromere protein S (CENP-S)-containing subcomplex that includes the new constitutive kinetochore protein CENP-X [Stra13]
8839844 Identification of human and mouse homologs of clone D9 of a murine promyelocyte cell line that was upregulated by retinoic acid.

AA Sequence

MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQL      1 - 70
EKVLPQLLLDF                                                                71 - 81
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25038251 2014 FANCM-associated proteins MHF1 and MHF2, but not the other Fanconi anemia factors, limit meiotic crossovers.
24699063 2014 The histone-fold complex MHF is remodeled by FANCM to recognize branched DNA and protect genome stability.
24522885 2014 A CENP-S/X complex assembles at the centromere in S and G2 phases of the human cell cycle.
24390579 2014 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
24256282 2013 Emerging roles for centromere-associated proteins in DNA repair and genetic recombination.
23886707 2013 Structural peculiarities of the (MHF1-MHF2)4 octamer provide a long DNA binding patch to anchor the MHF-FANCM complex to chromatin: a solution SAXS study.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22510687 2012 The structure of the FANCM-MHF complex reveals physical features for functional assembly.
22304917 2012 CENP-T-W-S-X forms a unique centromeric chromatin structure with a histone-like fold.
More...