Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.08
PubTator Score 2.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung adenocarcinoma 2,713

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.200 0.000

Synonym

Accession A8MT33 A6NF23
Symbols MRP2

Gene

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MAGKLKPLNVEAPEATEEAEGQAKSLKTEDLLAMVIKLQKEGSLEPQIEDLISRINDLQQAKKKSSEELR      1 - 70
ETHSLWEALHRELDSLNGEKVHLEEVLGKKQEALRILQMHCQEKESEAQRLDVRGQLEDLMGQHKDLWEF     71 - 140
HMLEQRLAREIRALERSKEQLLSERRLVRAKLREVERRLHSPPEVEGAMAVNDGLKAELEIFGEQVRSAP    141 - 210
EVGAGEGEAGPELPRARDEEDPEPPVAAPDAL                                          211 - 242
//

Text Mined References (3)

PMID Year Title
16328886 2005 Identification of a new transcript specifically expressed in mouse spermatocytes: mmrp2.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).