Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MT19
Symbols

Gene

PANTHER Protein Class (2)

 Compartment GO Term (0)

AA Sequence

MLKEELEGLNISVGIYQNTEEAFTVPLIPLGLKETKDIDFSVILKDFILEHYSEDGYLYEDEITDLMDPR      1 - 70
QACRTPSRDEARVELLMTYFIQLGFAWIRFKKYNTSPRIFFYRYDSLNGVLVSQQNLLLEKASVLFNTGA     71 - 140
LYTQIGTWRYWQMQAGLQSAIDAFQRAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLTQAQESVFEKI    141 - 210
SLPGIRNEFFMLVKVAQEAAKVGEVYQQLHAAMSQALVKENIPYSWASLACVKAHHYTALAHYFTAILLI    211 - 280
DHQVKPGMDLDHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLHRAMAHHEESVREASLCKKLRS    281 - 350
IEVLQKVLCAAQERSRLTYAQHQEDDDLLNLIHAPSVVAKTEQEPKGPLSVFLANKQWMPPRSNRFTAEE    351 - 420
GDLGFTLRGNAPVEVHFLDPYCSALVAGARGGDYIVSIQLVDCKWLTVSEVMKLLKSFGEDEIEMKVVSL    421 - 490
LDSTSSMHNKSATYSVGMQKTYSMICLAIDDDNKTDKTQKISKKLSFLSWGTNKNRQKSASTLCLPSVGA    491 - 560
ARPQVKKKLPSPFSLLNSDSSSY                                                   561 - 583
//

Text Mined References (1)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.