Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.63
PubTator Score 0.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.300 0.000
astrocytic glioma -1.500 0.015
ependymoma -1.600 0.023
oligodendroglioma 1.400 0.002
psoriasis -3.600 0.000
glioblastoma -1.900 0.000
osteosarcoma -3.100 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.500 0.001
medulloblastoma, large-cell -2.000 0.001
primitive neuroectodermal tumor -1.600 0.005
adrenocortical carcinoma -1.044 0.000
primary pancreatic ductal adenocarcinoma -1.033 0.008
pediatric high grade glioma -1.400 0.000
Breast cancer -1.500 0.000
Pick disease -1.100 0.000
ovarian cancer -1.700 0.000
pancreatic cancer -1.200 0.002

Synonym

Accession A8MSI8 A6NJT7 Q6X7B8
Symbols HSD24
C17orf108

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
24315451 3 SNPs associated with the fraction of exhaled nitric oxide in childhood asthma are rs3751972 in LYRM9; rs944722 in NOS2; and rs8069176 near GSDMB; all at 17q12-q21.

AA Sequence

MAPLPGAELVRRPLQLYRYLLRCCQQLPTKGIQQHYKHAVRQSFRVHSDEDNPERIQQIIKRAIEDADWI      1 - 70
MNKYKKQN                                                                   71 - 78
//

Text Mined References (4)

PMID Year Title
24315451 2014 Fraction of exhaled nitric oxide values in childhood are associated with 17q11.2-q12 and 17q12-q21 variants.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.