Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.42931382612529E-11
ovarian cancer 8492 7.92025316379732E-9
adrenocortical carcinoma 1427 2.91623471940612E-4
oligodendroglioma 2849 0.00269115924275881
ependymoma 2514 0.0101750166436299
astrocytic glioma 2241 0.0103770661155621
adrenocortical adenoma 134 0.0110869039586589
primary pancreatic ductal adenocarcinoma 1271 0.018283368905185
acute quadriplegic myopathy 1157 0.0182877037641674
pancreatic cancer 2300 0.0277908078547865

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 2.900 0.010
ependymoma 2.800 0.010
oligodendroglioma 3.400 0.003
osteosarcoma 4.383 0.000
acute quadriplegic myopathy 1.090 0.018
adrenocortical adenoma 1.376 0.011
adrenocortical carcinoma 1.501 0.000
primary pancreatic ductal adenocarcinoma 1.306 0.018
ovarian cancer -2.000 0.000
pancreatic cancer 1.200 0.028

Synonym

Accession A8MRT5 B4DK13
Symbols

Gene

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLHVIIAFPTS      1 - 70
YKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRSICMHTKKRVSSFRGNKIGLK     71 - 140
DVITLRRHVETKVRAKIRKRKVTTKINHHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKA    141 - 210
LCNWVRMAAAEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSITDNSLSLKTPPECLLTPLPPSADD    211 - 280
NLKTPPECVLTPLPPSADDNLKTPPECVLTPLPPSADDNLKTPPECLLTPLPPSADDNLKTPPECLLTPL    281 - 350
PPSALPSAPPSADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLP    351 - 420
PSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADD    421 - 490
NIKTPAERLRGPLPPSADDNLKTPSERQLTALPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPL    491 - 560
PPSAPPSADDNIKTPAFHPQRMISRHLPSVSSLPFHPQLHPQQMIISRYLLSVCGFRFHHQPMIISRHLP    561 - 630
SVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPERMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGG    631 - 700
RFHPQQMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQ    701 - 770
QMIISRHLPSVCGGRFHPQQMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLP    771 - 840
SVSSLPFHPQLHPQQMIISRHLPSVCGERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAE    841 - 910
RLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPS    911 - 980
APPSADDNIKTPAERLRGPLPPSADDNLKTPPLATQEAEAEKPRKPKRQRAAEMEPPPEPKRRRVGDVEP    981 - 1050
SRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADV   1051 - 1120
EPSLPEPKRRRLS                                                            1121 - 1133
//

Text Mined References (5)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948212 Divergent origins and concerted expansion of two segmental duplications on chromosome 16.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.