Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14
PubTator Score 0.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.300 2.2e-05
atypical teratoid / rhabdoid tumor -1.200 2.9e-09
glioblastoma -1.100 8.6e-05

AA Sequence

MGEKSRRKGPAPRHADGKLGRTCDHPYAPWSFTPSSRAPTAWVRPPCPVWASRLQEHSPEPRRARAPPTR      1 - 70
RAQAALYAPALRLRDHLDRFSILMTSCTSWLQAPQAPGLCRDEQSSRISVPQLSGAPILLPDLEGTKLSN     71 - 140
FQESSPLPHKHERKDKRSTPEEEGRSAPEKIIQSLKLCPGGHRPASLSSGCPAGCRLSFNLPPSMLLSVQ    141 - 210
KCCMPSSLKTC                                                               211 - 221
//

Text Mined References (4)

PMID Year Title