Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.79
PubTator Score 0.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 3.06313184876491E-24
juvenile dermatomyositis 1189 1.10969928073714E-9
ulcerative colitis 2087 1.99469386386455E-9
Duchenne muscular dystrophy 602 5.57367981913638E-5
ovarian cancer 8492 5.63428610678821E-5
interstitial cystitis 2299 3.12820950210009E-4
invasive ductal carcinoma 2950 4.82879108730428E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.27836038032497E-4
atypical teratoid / rhabdoid tumor 4369 7.16887239210957E-4
active Crohn's disease 918 0.00633229250510647
primary pancreatic ductal adenocarcinoma 1271 0.0110294989833673
pancreatic cancer 2300 0.0126943639546675
gastric carcinoma 832 0.0346531748371622
medulloblastoma 1524 0.0397562514950854
medulloblastoma, large-cell 6234 0.0483479859545793

Expression

Synonym

Accession A8MQ27 C9DQJ5 C9DQJ6 C9DQJ7
Symbols neur2
NEURL3
hNeur2

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA EggNOG

Gene RIF (1)

PMID Text
19723503 Neur2, in contrast to Neur1, is highly expressed during embryonic development of the brain and several non-neural tissues and its mRNA levels subside postnatally.

AA Sequence

MGNTVHRTLPDPSPPARLLATRPCCGPGPERRPVLGEAPRFHAQAKGKNVRLDGHSRRATRRNSFCNGVT      1 - 70
FTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIPKYACPDLVTRPGYWAKALPENLALR     71 - 140
DTVLAYWADRHGRVFYSVNDGEPVLFHCGVAVGGPLWALIDVYGITDEVQLLESAFADTLTPARLSQARF    141 - 210
SACLPPSSHDAANFDNNELENNQVVAKLGHLALGRAPGPPPADAAAAAIPCGPRERPRPASSPALLEADL    211 - 280
RFHATRGPDVSLSADRKVACAPRPDGGRTLVFSERPLRPGESLFVEVGRPGLAAPGALAFGITSCDPGVL    281 - 350
RPNELPADPDALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDVLLGINGRPRGRLLCVDTTQALWAFFA    351 - 420
VRGGVAGQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVF    421 - 490
SPPEPAGIKNGECTVCFDGEVDTVIYTCGHMCLCHSCGLRLKRQARACCPICRRPIKDVIKIYRP         491 - 555
//

Text Mined References (7)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19723503 2009 Neuralized-2: expression in human and rodents and interaction with Delta-like ligands.
17003037 2006 Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.