Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.79
PubTator Score 0.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A8MQ27 C9DQJ5 C9DQJ6 C9DQJ7
Symbols neur2
NEURL3
hNeur2

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19723503 Neur2, in contrast to Neur1, is highly expressed during embryonic development of the brain and several non-neural tissues and its mRNA levels subside postnatally.

AA Sequence

MGNTVHRTLPDPSPPARLLATRPCCGPGPERRPVLGEAPRFHAQAKGKNVRLDGHSRRATRRNSFCNGVT      1 - 70
FTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIPKYACPDLVTRPGYWAKALPENLALR     71 - 140
DTVLAYWADRHGRVFYSVNDGEPVLFHCGVAVGGPLWALIDVYGITDEVQLLESAFADTLTPARLSQARF    141 - 210
SACLPPSSHDAANFDNNELENNQVVAKLGHLALGRAPGPPPADAAAAAIPCGPRERPRPASSPALLEADL    211 - 280
RFHATRGPDVSLSADRKVACAPRPDGGRTLVFSERPLRPGESLFVEVGRPGLAAPGALAFGITSCDPGVL    281 - 350
RPNELPADPDALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDVLLGINGRPRGRLLCVDTTQALWAFFA    351 - 420
VRGGVAGQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVF    421 - 490
SPPEPAGIKNGECTVCFDGEVDTVIYTCGHMCLCHSCGLRLKRQARACCPICRRPIKDVIKIYRP         491 - 555
//

Text Mined References (7)

PMID Year Title
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19723503 2009 Neuralized-2: expression in human and rodents and interaction with Delta-like ligands.
17003037 2006 Neuralized-2 regulates a Notch ligand in cooperation with Mind bomb-1.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.