Property Summary

NCBI Gene PubMed Count 7
PubMed Score 48.30
PubTator Score 45.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Schizoaffective Disorder 55 3.495 1.7
Disease Target Count Z-score Confidence
Succinic semialdehyde dehydrogenase deficiency 16 3.308 1.7

Gene RIF (4)

AA Sequence

MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQKYEQLLHIEDN      1 - 70
DFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLSFPSTANKSMTFDHRLTRKIW     71 - 140
VPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITVSAMCFMDFSRFPLDTQNCSLELESYAYNED    141 - 210
DLMLYWKHGNKSLNTEEHMSLSQFFIEDFSASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAIL    211 - 280
MVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAA    281 - 350
VNYLTTVEERKQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS    351 - 420
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV                           421 - 467
//

Text Mined References (7)

PMID Year Title