Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.02
PubTator Score 0.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-small cell lung cancer 1.326 0.000
pediatric high grade glioma -1.100 0.000
lung adenocarcinoma 1.100 0.000

Synonym

Accession A8MPS7 Q2YDT4 Q4V9R7
Symbols

Gene

AA Sequence

MSRPRMRLVVTADDFGYCPRRDEGIVEAFLAGAVTSVSLLVNGAATESAAELARRHSIPTGLHANLSEGR      1 - 70
PVGPARRGASSLLGPEGFFLGKMGFREAVAAGDVDLPQVREELEAQLSCFRELLGRAPTHADGHQHVHVL     71 - 140
PGVCQVFAEALQAYGVRFTRLPLERGVGGCTWLEAPARAFACAVERDARAAVGPFSRHGLRWTDAFVGLS    141 - 210
TCGRHMSAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSCSWERLHELRVLTAP    211 - 280
TLRAQLAQDGVQLCALDDLDSKRPGEEVPCEPTLEPFLEPSLL                               281 - 323
//

Text Mined References (11)

PMID Year Title
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
18177738 2008 Crystal structure of the YdjC-family protein TTHB029 from Thermus thermophilus HB8: structural relationship with peptidoglycan N-acetylglucosamine deacetylase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...