Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.02
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 6.0e-23
lung adenocarcinoma 2716 9.3e-10
pediatric high grade glioma 1064 2.0e-05
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.4

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.100 9.3e-10
non-small cell lung cancer 1.326 6.0e-23
pediatric high grade glioma -1.100 2.0e-05

AA Sequence

MSRPRMRLVVTADDFGYCPRRDEGIVEAFLAGAVTSVSLLVNGAATESAAELARRHSIPTGLHANLSEGR      1 - 70
PVGPARRGASSLLGPEGFFLGKMGFREAVAAGDVDLPQVREELEAQLSCFRELLGRAPTHADGHQHVHVL     71 - 140
PGVCQVFAEALQAYGVRFTRLPLERGVGGCTWLEAPARAFACAVERDARAAVGPFSRHGLRWTDAFVGLS    141 - 210
TCGRHMSAHRVSGALARVLEGTLAGHTLTAELMAHPGYPSVPPTGGCGEGPDAFSCSWERLHELRVLTAP    211 - 280
TLRAQLAQDGVQLCALDDLDSKRPGEEVPCEPTLEPFLEPSLL                               281 - 323
//

Text Mined References (11)

PMID Year Title