Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 2.3e-02
atypical teratoid / rhabdoid tumor -2.300 1.5e-04
glioblastoma -1.900 1.9e-04
medulloblastoma, large-cell -2.300 1.9e-04
osteosarcoma 2.319 9.6e-09
pancreatic cancer 1.100 3.9e-03
pancreatic carcinoma 1.100 3.9e-03
Pick disease 1.100 5.9e-04
tuberculosis and treatment for 6 months -1.100 4.2e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MGPPLAPRPAHVPGEAGPRRTRESRPGAVSFADVAVYFSPEEWECLRPAQRALYRDVMRETFGHLGALGF      1 - 70
SVPKPAFISWVEGEVEAWSPEAQDPDGESSAAFSRGQGQEAGSRDGNEEKERLKKCPKQKEVAHEVAVKE     71 - 140
WWPSVACPEFCNPRQSPMNPWLKDTLTRRLPHSCPDCGRNFSYPSLLASHQRVHSGERPFSCGQCQARFS    141 - 210
QRRYLLQHQFIHTGEKPYPCPDCGRRFRQRGSLAIHRRAHTGEKPYACSDCKSRFTYPYLLAIHQRKHTG    211 - 280
EKPYSCPDCSLRFAYTSLLAIHRRIHTGEKPYPCPDCGRRFTYSSLLLSHRRIHSDSRPFPCVECGKGFK    281 - 350
RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDIFQECG                   351 - 405
//

Text Mined References (7)

PMID Year Title