Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.100 0.004
osteosarcoma 2.319 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
glioblastoma -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
tuberculosis and treatment for 6 months -1.100 0.000
adult high grade glioma -1.400 0.023
pancreatic carcinoma 1.100 0.004
Pick disease 1.100 0.001

Gene RIF (1)

PMID Text
18187620 Knockdown of zinc finger protein 785 (ZNF785) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGPPLAPRPAHVPGEAGPRRTRESRPGAVSFADVAVYFSPEEWECLRPAQRALYRDVMRETFGHLGALGF      1 - 70
SVPKPAFISWVEGEVEAWSPEAQDPDGESSAAFSRGQGQEAGSRDGNEEKERLKKCPKQKEVAHEVAVKE     71 - 140
WWPSVACPEFCNPRQSPMNPWLKDTLTRRLPHSCPDCGRNFSYPSLLASHQRVHSGERPFSCGQCQARFS    141 - 210
QRRYLLQHQFIHTGEKPYPCPDCGRRFRQRGSLAIHRRAHTGEKPYACSDCKSRFTYPYLLAIHQRKHTG    211 - 280
EKPYSCPDCSLRFAYTSLLAIHRRIHTGEKPYPCPDCGRRFTYSSLLLSHRRIHSDSRPFPCVECGKGFK    281 - 350
RKTALEAHRWIHRSCSERRAWQQAVVGRSEPIPVLGGKDPPVHFRHFPDIFQECG                   351 - 405
//

Text Mined References (7)

PMID Year Title
26063658 2015 Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease.
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.