Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.32
PubTator Score 4.16

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
24154973 Data implicate COLCA1 and COLCA2 in the pathogenesis of colon cancer.
24146276 We found PLCE1, C11orf92-C11orf93, and NOC3L associated with colorectal cancer susceptibility
21071539 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18753146 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASL      1 - 70
DTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATS     71 - 140
DFYKRETNCDICYS                                                            141 - 154
//

Text Mined References (15)

PMID Year Title
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24154973 2014 Identification of genes expressed by immune cells of the colon that are regulated by colorectal cancer-associated variants.
24146276 2014 Genetic association of PLCE1, C11orf92-C11orf93, and NOC3L with colorectal cancer risk in the Han population.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
21761138 2012 Meta-analysis of new genome-wide association studies of colorectal cancer risk.
21071539 2011 Generalizability and epidemiologic characterization of eleven colorectal cancer GWAS hits in multiple populations.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18753146 2008 Refinement of the basis and impact of common 11q23.1 variation to the risk of developing colorectal cancer.
18372901 2008 Genome-wide association scan identifies a colorectal cancer susceptibility locus on 11q23 and replicates risk loci at 8q24 and 18q21.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...