Property Summary

NCBI Gene PubMed Count 43
Grant Count 56
R01 Count 38
Funding $6,873,847.31
PubMed Score 129.42
PubTator Score 95.14

Knowledge Summary

Patent (15,980)

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 3.100 0.004
intraductal papillary-mucinous carcinoma... 3.800 0.038
colon cancer -6.200 0.009

Gene RIF (36)

PMID Text
26004777 inhibitor and siRNA transfection studies demonstrated an apparent effect of CLCA1 on ovarian cancer cell aggregation
25781344 Data show that calcium-activated chloride channel regulator 1 (CLCA1) and transmembrane protein 16A (TMEM16A) co-localize and physically interact and that CLCA1 increases the level of TMEM16A protein at the cell surface.
25603912 Results confirmed that the low expression of CLCA1 in CRC was associated with tumorigenesis, early metastasis, and high chromosomal instability. Low expression of CLCA1 predicts recurrence and lower survival.
24349445 These findings demonstrate the ability of hCLCA1 to function as a signaling molecule and activate macrophages, central regulators of airway inflammation.
23593331 CLCA1 may contribute to promoting spontaneous differentiation and reducing proliferation of Caco-2 cells.
23112050 These data provide both a mechanistic basis for CLCA1 self-cleavage and a novel mechanism for regulation of chloride channel activity specific to the mucosal interface.
22731784 CLCA1 expression is significantly related to mucus production in the airway epithelia of smokers and COPD patients, and may contribute to the development and pathogenesis of COPD by inducing mucus production.
21762802 HIV-1 gp120 from both CCR5- and CXCR4-tropic HIV-1 strains opens calcium-activated potassium (K(Ca)), chloride, and calcium-permeant nonselective cation channels in macrophages; these signals are mediated by CCR5 and CXCR4
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20542744 in cultured nasal airway cells, Th2 type cytokines increased hCLCA1 (calcium-activated chloride channel 1) expression in Cystic Fibrosis patients but not mucus expression
More...

AA Sequence

MGPFKSSVFILILHLLEGALSNSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLLEATGK      1 - 70
RFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIA     71 - 140
GKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRC    141 - 210
TFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSE    211 - 280
DFKKTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFD    281 - 350
SAAHVQNELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISG    351 - 420
CFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNGAVSQRSIQLE    421 - 490
SKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDKNTKMAYLQIPGIAK    491 - 560
VGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPILRASVTALI    561 - 630
ESVNGKTVTLELLDNGAGADATKDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPG    631 - 700
WIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLIN    701 - 770
LTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDL    771 - 840
FIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQ    841 - 910
LSIA                                                                      911 - 914
//

Text Mined References (50)

PMID Year Title
26004777 2015 Comparative Proteomics of Ovarian Cancer Aggregate Formation Reveals an Increased Expression of Calcium-activated Chloride Channel Regulator 1 (CLCA1).
25781344 2015 Secreted CLCA1 modulates TMEM16A to activate Ca(2+)-dependent chloride currents in human cells.
25603912 2015 Low expression of chloride channel accessory 1 predicts a poor prognosis in colorectal cancer.
24349445 2013 Secreted hCLCA1 is a signaling molecule that activates airway macrophages.
23593331 2013 The transition from proliferation to differentiation in colorectal cancer is regulated by the calcium activated chloride channel A1.
23112050 2012 Self-cleavage of human CLCA1 protein by a novel internal metalloprotease domain controls calcium-activated chloride channel activation.
22731784 2012 Increased human Ca²?-activated Cl? channel 1 expression and mucus overproduction in airway epithelia of smokers and chronic obstructive pulmonary disease patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20542744 2010 Effect of Th2 type cytokines on hCLCA1 and mucus expression in cystic fibrosis airways.
20464982 2010 [Expression and clinical significance of calcium-activated chloride channel and mucins in nasal mucosa with allergic rhinitis].
More...