Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
spina bifida 1074 3.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -1.279 3.8e-02

Synonym

Accession A8K5M9 A6NK01
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

METWRKGSFRNASFFKQLSLGRPRRLRRQSSVLSQASTAGGDHEEYSNREVIRELQGRPDGRRLPLWGDE      1 - 70
QPRATLLAPPKPPRLYRESSSCPNILEPPPAYTAAYSATLPSALSLSSALHQHSEKGLVDTPCFQRTPTP     71 - 140
DLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF                                       141 - 175
//

Text Mined References (7)

PMID Year Title