Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8K554
Symbols ZNF815

Gene

 Compartment GO Term (0)

AA Sequence

MEEEEIRTWSFPEEVWQVATQPDSQQQHEDQHLSHTFLDKKDWTGNELHECNELGKKLHQNPNLLPSKQQ      1 - 70
VRTRDLCRKSLMCNLDFTPNAYLARRRFQCDGHGNFFSVRNLKLHLQERIHAEVTSVEVL               71 - 130
//

Text Mined References (3)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.